Loading...
Statistics
Advertisement

RAUESSO.com | Blog de Raúl Espinosa SorianoRAUESSO.com | Blog de ...
www.rauesso.com/

Rauesso.com

Advertisement
Conversion Technology Metas Server
Rauesso.com is hosted in Germany . Rauesso.com doesn't use HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Flexslider, Font Awesome, Number of used javascripts: 6. First javascripts: Jquery.js, Jquery-migrate.min.js, Collapse.js, Number of used analytics tools: 0. Its server type is: Apache. Its CMS is: Wordpress.

Technologies in use by Rauesso.com

Technology

Number of occurences: 8
  • CSS
  • Flexslider
  • Font Awesome
  • Html
  • Javascript
  • jQuery
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 6
  • jquery.js
  • jquery-migrate.min.js
  • collapse.js
  • jquery.flexslider-min.js
  • menu.js
  • slider.js

Content Management System

Number of occurences: 1
  • Wordpress

Server Type

  • Apache

Powered by

  • PHP/5.6.22

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Rauesso.com

Missing HTTPS protocol.

    Meta - Rauesso.com

    Number of occurences: 3
    • Name:
      Content: text/html
    • Name: viewport
      Content: width=device-width, initial-scale=1.0
    • Name: generator
      Content: WordPress 4.3.5

    Server / Hosting

    • IP: 217.160.230.91
    • Latitude: 51.30
    • Longitude: 9.49
    • Country: Germany

    Rname

    • ns-es.1and1-dns.com
    • ns-es.1and1-dns.biz
    • ns-es.1and1-dns.es
    • ns-es.1and1-dns.org
    • mx00.1and1.es
    • mx01.1and1.es

    Target

    • hostmaster.1and1.com

    HTTP Header Response

    HTTP/1.1 200 OK Date: Mon, 04 Jul 2016 16:11:52 GMT Content-Type: text/html; charset=UTF-8 Server: Apache X-Powered-By: PHP/5.6.22 X-Pingback: http://rauesso.com/xmlrpc.php X-Cache: MISS from s_mf15 X-Cache-Lookup: MISS from s_mf15:80 Via: 1.1 s_mf15 (squid/3.5.6) Connection: keep-alive

    DNS

    host: rauesso.com
    1. class: IN
    2. ttl: 23
    3. type: A
    4. ip: 217.160.230.91
    host: rauesso.com
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns-es.1and1-dns.com
    host: rauesso.com
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns-es.1and1-dns.biz
    host: rauesso.com
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns-es.1and1-dns.es
    host: rauesso.com
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns-es.1and1-dns.org
    host: rauesso.com
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: ns-es.1and1-dns.es
    5. rname: hostmaster.1and1.com
    6. serial: 2016040100
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 600
    host: rauesso.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx00.1and1.es
    host: rauesso.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx01.1and1.es
    host: rauesso.com
    1. class: IN
    2. ttl: 39623
    3. type: AAAA
    4. ipv6: 2001:8d8:1001:1126:b90e:94b:e0e4:29

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.auesso.com, www.riauesso.com, www.iauesso.com, www.roauesso.com, www.oauesso.com, www.rlauesso.com, www.lauesso.com, www.rlauesso.com, www.lauesso.com, www.r.auesso.com, www..auesso.com, www.ruesso.com, www.raouesso.com, www.rouesso.com, www.rapuesso.com, www.rpuesso.com, www.ra9uesso.com, www.r9uesso.com, www.rauesso.com, www.ruesso.com, www.raiuesso.com, www.riuesso.com, www.rauuesso.com, www.ruuesso.com, www.raesso.com, www.rauwesso.com, www.rawesso.com, www.raueesso.com, www.raeesso.com, www.rausesso.com, www.rasesso.com, www.rauaesso.com, www.raaesso.com, www.rausso.com, www.rauexsso.com, www.rauxsso.com, www.rauessso.com, www.raussso.com, www.rauewsso.com, www.rauwsso.com, www.rauersso.com, www.raursso.com, www.rauefsso.com, www.raufsso.com, www.rauevsso.com, www.rauvsso.com, www.rauecsso.com, www.raucsso.com, www.raueqsso.com, www.rauqsso.com, www.raueasso.com, www.rauasso.com, www.raueysso.com, www.rauysso.com, www.raueso.com, www.raueseso.com, www.raueeso.com, www.raueswso.com, www.rauewso.com, www.rauesdso.com, www.rauedso.com, www.rauesxso.com, www.rauexso.com, www.rauesfso.com, www.rauefso.com, www.rauesgso.com, www.rauegso.com, www.rauestso.com, www.rauetso.com, www.raueso.com, www.rauesseo.com, www.raueseo.com, www.rauesswo.com, www.raueswo.com, www.rauessdo.com, www.rauesdo.com, www.rauessxo.com, www.rauesxo.com, www.rauessfo.com, www.rauesfo.com, www.rauessgo.com, www.rauesgo.com, www.rauessto.com, www.rauesto.com, www.rauess.com, www.rauessob.com, www.rauessb.com, www.rauessoh.com, www.rauessh.com, www.rauessog.com, www.rauessg.com, www.rauessoj.com, www.rauessj.com, www.rauessom.com, www.rauessm.com, www.rauesso .com, www.rauess .com, www.rauessov.com, www.rauessv.com,

    Other websites we recently analyzed

    1. chefs2you.com
      United States - 192.195.77.236
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    2. Overseesjob
      United Kingdom - 95.215.224.23
      Server software: Microsoft-IIS/7.5
      Technology: BootstrapCDN, CSS, Font Awesome, Html, Javascript, jQuery, SVG
      Number of Javascript: 169
      Number of meta tags: 1
    3. federalcriminalappealslawyers.com
      Scottsdale (United States) - 50.63.202.60
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    4. sanvini.nl
      sanvini.nl
      Netherlands - 62.148.163.233
      Server software: Apache
      Technology: CSS, Html, Html5
      Number of Javascript: 1
      Number of meta tags: 6
    5. Spółdzielnia Mieszkaniowa w Jarosławiu
      Jaroslaw (Poland) - 185.25.120.34
      Server software:
      Technology: BootstrapCDN, CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, jQuery UI, Lightbox, Php, Pingback, Wordpress
      Number of Javascript: 44
      Number of meta tags: 4
    6. eternal-promi.se.net
      San Jose (United States) - 205.164.14.88
      Server software: Tengine/1.4.2
      Technology: Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1
    7. 508 Espacio Pop Up · Valencia | Diseño, Moda, Eventos, Talleres
      Espacio en el centro de Valencia donde damos cabida a diseñadores, exposiciones, tiendas... Un lugar efímero lleno de creatividad y nuevas experiencias.
      France - 5.135.78.248
      Server software: nginx
      Technology: CSS, Flexslider, Font Awesome, Google Font API, Gravatar, Html, Html5, Iframe, Javascript, jQuery, Php, Pingback, Revslider, Shortcodes, WordPress Stats, Wordpress
      Number of Javascript: 37
      Number of meta tags: 5
    8. My Blog – My WordPress Blog
      Austin (United States) - 198.54.116.10
      Server software: Apache
      Technology: CSS, Google Font API, Gravatar, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 5
      Number of meta tags: 3
    9. armorygp.com
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    10. Kaplan Investment / Eda Konutları Antalya
      We provide free flash templates, free templates, free flash header
      Ankara (Turkey) - 217.116.199.188
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Javascript
      Number of Javascript: 7
      Number of meta tags: 2

    Check Other Websites